Amylin, rat

SKU: orb2693385

Description

Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.

Images & Validation

−

Key Properties

−

Target	Amylin Receptor
CAS Number	124447-81-0
MW	3920.44
Purity	≥95%
Formula	C₁₆₇H₂₇₂N₅₂O₅₃S₂
Protein Sequence	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Amylin Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Reactivity:	Rat
Dynamic Range:	7.82-500 pg/mL
Sensitivity:	2.73 pg/mL

Reactivity:	Rat
Dynamic Range:	62.5-4000pg/mL
Sensitivity:	37.5 pg/mL

Applications:	IHC-P
Predicted Reactivity:	Human
Reactivity:	Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Reactivity:	Rat
Dynamic Range:	78-5000pg/ml
Sensitivity:	46.9pg/ml

Amylin, rat

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

Rat Islet Amyloid Polypeptide (IAPP) ELISA Kit [orb775466]

Rat Islet Amyloid Polypeptide (IAPP) ELISA Kit [orb1946795]

Amylin Rabbit Polyclonal Antibody [orb395796]

Rat Iapp ELISA Kit [orb566889]

Amylin (8-37), rat [orb321403]

Quality Guarantee

Quick Database Links

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors