Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ANPEP Rabbit Polyclonal Antibody

SKU: orb333733

Description

ANPEP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ANPEP. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human ANPEP. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANPEP
TargetANPEP
Protein SequenceSynthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
Molecular Weight106kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Alanyl aminopeptidase antibody, anti Alanyl membrane aminopeptidase antibody, anti Aminopeptidase M antibody, anti Aminopeptidase N antibody, anti ANPEP antibody, anti AP M antibody, anti AP N antibody, anti AP-M antibody, anti AP-N antibody, anti APN antibody, anti CD 13 antibody, anti CD13 antibody, anti CD13 antigen antibody, anti gp150 antibody, anti hAPN antibody, anti Microsomal aminopeptidase antibody, anti Myeloid plasma membrane glycoprotein CD13 antibody, anti PEPN antibody

Similar Products

  • CD13/Anpep Rabbit Polyclonal Antibody [orb623840]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CD13/ANPEP Rabbit Polyclonal Antibody [orb623839]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CD13 rabbit pAb Antibody [orb767184]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • CD13 Rabbit Polyclonal Antibody [orb10293]

    FC,  IF,  IHC-Fr,  IHC-P

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ANPEP Rabbit Polyclonal Antibody [orb625549]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001141

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry