You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−
Item 1 of 1
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Neisseria meningitidis serogroup B (strain MC58) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 20-331aa |
| Protein Length | Full Length of Mature Protein |
| MW | 37.8 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Class 3 protein Porin
Similar Products
−- Item 1 of 3
Bacteria porB protein [orb604618]
Greater than 85% as determined by SDS-PAGE.
37.9 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Bacteria porB protein [orb604628]
Greater than 85% as determined by SDS-PAGE.
37.8 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Bacteria porB protein [orb604658]
Greater than 85% as determined by SDS-PAGE.
37.8 kDa
E.coli
20 μg, 1 mg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks