Bovine CCL11 protein

SKU: orb1215729

Description

The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072).

Research Area

Immunology & Inflammation

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Bovine
Target	CCL11
Protein Length	74.0
MW	8.6 kDa
Purity	98%
Protein Sequence	QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Eotaxin-1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CCL11

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Reactivity:	Bovine
Dynamic Range:	62.5-4000pg/mL
Sensitivity:	27.38pg/mL

Reactivity:	Bovine
Dynamic Range:	62.5-4000 pg/mL
Sensitivity:	28.6 pg/mL

Reactivity:	Bovine
Dynamic Range:	62.5-4000 pg/mL
Sensitivity:	28.6 pg/mL