You have no items in your shopping cart.
Description
Research Area
Hormone Research
Images & Validation
−
Key Properties
−| Target | Vasopressin-neurophysin 2-copeptin |
|---|---|
| Purification | HPLC |
| MW | 3.95 kDa |
| Protein Sequence | SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Vasopressin; Antidiuretic Hormone; Arginine Vasopressin; ADH; Arginine vasopressin neurophysin II; ARVP; AVP; AVP NPII; AVRP; Vasopressin neurophysin 2 copeptin precursor; Vasopressin neurophysin II copeptin; VP.
Similar Products
−Copeptin (rat) [orb3054027]
>98% (HPLC)
86280-64-0
4281.74
C183H307N57O61
25 mg, 50 mg, 100 mg, 5 mg, 10 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Vasopressin-neurophysin 2-copeptin
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
