You have no items in your shopping cart.
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−![[DPro5] Corticotropin Releasing Factor, human, rat](/images/quality_badge_proteins.png)
Key Properties
−| Target | CRFR |
|---|---|
| CAS Number | 195628-97-8 |
| MW | 4757.45 |
| Purity | ≥95% |
| Formula | C208H344N60O63S2 |
| Protein Sequence | SEEP-{D-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
CRFR
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide