Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

[DPro5] Corticotropin Releasing Factor, human, rat

SKU: orb2694799

Description

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.

Research Area

Pharmacology & Drug Discovery

Images & Validation

Key Properties

TargetCRFR
CAS Number195628-97-8
MW4757.45
Purity≥95%
FormulaC208H344N60O63S2
Protein SequenceSEEP-{D-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Storage & Handling

Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide