Fgfr1 Rabbit Polyclonal Antibody

SKU: orb585522

Description

Fgfr1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Fgfr1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgfr1. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgfr1
Target	Fgfr1
Protein Sequence	Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM
Molecular Weight	92kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Ea, Fr, Hs, FLG, Fr1, MFR, Eask, FGFR, Flt-, Hspy, Fgfr-, Flt-2, c-fgr, FGFR-I, Fgfr-1, AW208770, bFGF-R-1

Phospho-FGFR1 (Tyr307) Rabbit Polyclonal Antibody [orb5240]

Applications:	ELISA, IF, IHC-Fr, IHC-P
Predicted Reactivity:	Bovine, Equine, Gallus, Guinea pig, Mouse, Porcine
Reactivity:	Human, Rabbit, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 50 μl, 100 μl, 200 μl

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Fgfr1

UniProt

P16092

RefSeq (Protein):NP_034336

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_034336

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols