You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Chicken |
| Target | CCL4 |
| Protein Length | 69.0 |
| MW | 7.8 kDa |
| Purity | 98% |
| Protein Sequence | APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MIP-1 beta
Similar Products
−Chicken Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit [orb776742]
Gallus
31.25-2000 pg/mL
14.3 pg/mL
48 T, 96 TGallus CCL4 ELISA Kit [orb1216633]
Gallus
1 set (1 x capture antibody), 1 set (2 x capture antibody)

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
CCL4
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


