Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GIP (1-39)

SKU: orb1140533

Description

Endogenous truncated form of GIP; Peptides.

Research Area

Metabolism Research

Images & Validation

Key Properties

CAS Number725474-97-5
MW4633.2 Da
Purity> 95% By HPLC
FormulaC210H316N56O61S
Protein SequenceH-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH

Storage & Handling

StorageStore dark, dry and frozen
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

endogenous, food intake, 725474-97-5GH160, GIP (1-39), Gastric Inhibitory Polypeptide, Glucose-dependent Insulinotropic Polypeptide, YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, diabetes, insulinotropic

Similar Products

  • GIP (1-39) acetate [orb1296394]

    98.93% (May vary between batches)

    4693.21

    1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
  • Neochlorogenic acid methyl ester [orb1297054]

    99.91% (May vary between batches)

    123410-65-1

    368.34

    C17H20O9

    2 mg, 1 ml x 10 mM (in DMSO), 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 1 mg
  • GIP (1-39) [orb1679332]

    4633.21

    1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 370.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry