You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14, the EC50 is 137.8-233.4 ng/ml. |
| Tag | C-terminal hFc1-Myc-tagged |
| Expression Region | 31-150aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 43.9 kDa |
| Purity | Greater than 94% as determined by SDS-PAGE. |
| Protein Sequence | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(B- and T-lymphocyte-associated protein)(CD272)
Similar Products
−- Item 1 of 5
CD272/BTLA Human Monoclonal Antibody [orb2977562]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg - Item 1 of 1
Human B- and T-lymphocyte attenuator (BTLA) ELISA Kit [orb782463]
Human
0.47-30 ng/mL
0.22 ng/mL
48 T, 96 T - Item 1 of 4
Human BTLA Protein, mFc-His Tag [orb689405]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.3 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg 
Recombinant Human BTLA Protein [orb2994992]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.79 KDa. Observed: 30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human BTLA Protein [orb2994015]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 40.9 KDa. Observed: 55 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks