You have no items in your shopping cart.
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody, the EC50 is 23.17-26.04 ng/mL. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 62-199aa |
| Protein Length | Partial |
| MW | 18.0 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(Activation inducer molecule)(AIM)(BL-AC/P26)(C-type lectin domain family 2 member C)(EA1)(Early T-cell activation antigen p60)(GP32/28)(Leukocyte surface antigen Leu-23)(MLR-3)(CD antigen CD69)
Similar Products
−Recombinant Human CD69 Protein [orb2994135]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 16.9 KDa. Observed: 18-28 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 4
CD69 Rabbit Polyclonal Antibody [orb654412]
ELISA, FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Human CD69 Protein, hFc Tag [orb1173857]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.1 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CD69 is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days