You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cell Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml. |
| Tag | Tag-Free |
| Expression Region | 24-198aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 19.9 kDa |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | II+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−DHH,
Similar Products
−
RecombinantShh,Mouse(CHO-expressed) [orb1494667]
> 95% as analyzed by SDS-PAGE and HPLC.
20 kDa, observed by non-reducing SDS-PAGE.
CHO
1 mg, 10 μg, 50 μgRecombinant Human Sonic HedgeHog (Shh) [orb1494940]
>98% by SDS-PAGE and HPLC analyses.
Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.
Escherichia coli
5 μg, 25 μg, 1 mgRecombinantDHH,Human [orb1494898]
> 95% by SDS-PAGE and HPLC analyses.
~20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinantIHH,Human [orb1494835]
> 95% as analyzed by SDS-PAGE.
20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 50 μg, 10 μgRecombinant Human Desert hedgehog protein(DHH) (Active) [orb1650733]
>96% as determined by SDS-PAGE and HPLC.
19.9 kDa
1 mg, 500 μg, 250 μg, 100 μg, 25 μg, 5 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks