Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL-13 protein

SKU: orb1215950

Description

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginHuman
TargetIL-13
Protein Length112.0
MW12.3 kDa
Purity98%
Protein SequenceGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Human IL-13 R alpha 2 Protein, His Tag [orb612134]

    Unconjugated

    90%

    39.0 kDa

    100 μg, 1 mg
  • Human IL13 protein [orb594786]

    Greater than 95% as determined by SDS-PAGE.

    13.4 kDa

    Mammalian cell

    50 μg, 10 μg, 1 mg, 500 μg
  • Human IL13 protein (Active) [orb358978]

    > 97% as determined by SDS-PAGE and HPLC.

    12.3 kDa

    E.Coli

    500 μg, 100 μg, 10 μg
  • Human IL13 protein (Active) [orb358979]

    > 97% as determined by SDS-PAGE and HPLC.

    12.5 kDa

    E.Coli

    500 μg, 100 μg, 10 μg
  • Recombinant Human IL-13RA1 Protein [orb2994201]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 37.7 KDa. Observed: 55-65 KDa, reducing conditions

    500 μg, 1 mg, 10 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry