You have no items in your shopping cart.
Featured
Description
Research Area
Cell Biology
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 31-205aa |
| Protein Length | Partial |
| MW | 23.4 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD_antigen, CD215
Similar Products
−- Item 1 of 1
CD215/IL15RA Mouse Monoclonal Antibody [orb2958623]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 1
Human IL15RA protein [orb594809]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
Mammalian cell
50 μg, 10 μg, 1 mg, 500 μg - Item 1 of 1
Human IL15RA protein [orb594821]
Greater than 95% as determined by SDS-PAGE.
46.9 kDa
Mammalian cell
50 μg, 10 μg, 1 mg, 500 μg - Item 1 of 1
Human IL15RA Protein, hFc Tag [orb1173911]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Recombinant Human CD215/IL15RA Protein, N-GST & C-His [orb2962989]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
36.33 kDa
1 mg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks