You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cell Biology
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 26-161aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 40.8 kDa |
| Purity | Greater than 92% as determined by SDS-PAGE. |
| Protein Sequence | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
Human Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR) ELISA Kit [orb778161]
Human
15.63-1000 pg/mL
6.7 pg/mL
48 T, 96 T 
Recombinant Human GITR Protein [orb2994301]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 41.2 KDa. Observed: 42-50 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human GITR Protein [orb2994045]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 41.1 KDa. Observed: 40-55 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse GITR Protein [orb2993965]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 42.3 KDa. Observed: 60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 3
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks