You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BBL-His at 10μg/ml can bind Human 4-1BB-Fc, the ED50 of Human 4-1BB-Fc is 16.8 ng/ml. |
| Tag | C-terminal Fc-tagged |
| Expression Region | 24-186aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 44.2 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
Similar Products
−
Recombinant Human 4-1BB Protein [orb2994312]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 44.2 KDa. Observed: 58 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human 4-1BB Protein [orb2994314]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.1 KDa. Observed: 28-35 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μgRecombinant Human 4-1BB Protein [orb2994490]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 44 KDa. Observed: 55-75 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Cynomolgus 4-1BB Protein [orb2994767]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 44.4 KDa. Observed: 60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human 4-1BB Protein (Biotin) [orb2993093]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.9 KDa. Observed: 27-35 KDa, reducing conditions
20 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks