Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

MAP2K7 Rabbit Polyclonal Antibody

SKU: orb325434

Description

MAP2K7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MAP2K7. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7
TargetMAP2K7
Protein SequenceSynthetic peptide located within the following region: KDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTS
Molecular Weight50kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MAP2K7 antibody, anti JNKK2 antibody, anti MEK7 antibody, anti MKK7 antibody, anti PRKMK7 antibody, anti SKK4 antibody, anti antibody

Similar Products

  • MAP2K7 Rabbit Polyclonal Antibody [orb378212]

    IHC-P,  WB

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-MEK7 (Ser271 + Thr275) Rabbit Polyclonal Antibody [orb6592]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MEK-7 (phospho Ser271) rabbit pAb Antibody [orb769708]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • MEK7 Rabbit Polyclonal Antibody [orb13630]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Mouse, Porcine, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • MAP2K7 Rabbit Polyclonal Antibody [orb389339]

    IHC-P,  WB

    Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry