You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse B7-1-Fc at 5μg/ml can bind Mouse CTLA-4-His, the ED50 of Recombinant Mouse CTLA-4-His is 2-10 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 37-161aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 14.6 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4
Similar Products
−- Item 1 of 1
Mouse Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) ELISA Kit [orb1291269]
Mouse
31.25-2000 pg/mL
12.6 pg/mL
48 T, 96 T 
Recombinant Mouse CTLA-4 Protein [orb2994188]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.7 KDa. Observed: 20-25 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgRecombinant Mouse CTLA-4 Protein [orb2994213]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 40.4 KDa. Observed: 50-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse CTLA-4 Protein [orb2994293]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.6 KDa. Observed: 17-30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CTLA-4 Protein [orb2994048]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 40.1 KDa. Observed: 45-55 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks