Porcine CCL3L1 protein

SKU: orb1216345

Description

The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459).

Research Area

Immunology & Inflammation

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Swine
Target	CCL3L1
Protein Length	70.0
MW	7.8 kDa
Purity	98%
Protein Sequence	APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

LD78

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CCL3L1

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Reactivity:	Porcine
Dynamic Range:	78.13-5000pg/mL
Sensitivity:	25.23pg/mL