RANBP9 Rabbit Polyclonal Antibody

SKU: orb582160

Description

RANBP9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RANBP9. It is suitable for WB application. The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Signal Transduction

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9
Target	RANBP9
Protein Sequence	Synthetic peptide located within the following region: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG
Molecular Weight	42 kDa
Purification	Affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

BPM-L, BPM90, RANBPM, RanBP7