Rabbit IFN gamma protein

SKU: orb1215705

Description

The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602).

Research Area

Infectious Disease & Virology

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Rabbit
Target	IFN gamma
Protein Length	144.0
MW	16.9 kDa
Purity	98%
Protein Sequence	QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IFN gamma

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Applications:	ELISA, FC, ICC, IF, IHC, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, FC, ICC, IF, IHC, WB
Reactivity:	Human, Mouse
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	IF, IHC, WB
Reactivity:	Human, Monkey, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, WB
Purity:	>95% by SDS PAGE analysis

Applications:	IHC
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Monoclonal
Conjugation:	Unconjugated

Rabbit IFN gamma protein

Description

Research Area

Images & Validation

Key Properties

Storage & Handling

Similar Products

Sam68/KHDRBS1 Rabbit Polyclonal Antibody [orb1743880]

LARP1 Rabbit Polyclonal Antibody [orb865635]

IFNGR1 (Phospho-Y457) Rabbit Polyclonal Antibody [orb214083]