You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Dilution Range | Western blot: 0.1-1.0 µg/ml |
| Reactivity | Human |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG/IgM |
| Immunogen | IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI - αα 412-458 |
| Target | CD4 |
| Molecular Weight | 51 111 |
| Purification | Immunogen affinity column |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | Glycine pH 7.2 |
| Concentration | Batch dependent within range 2.0-2.5 mg/mL |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_000607.1 |
|---|
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)


