You have no items in your shopping cart.
Recombinant Human Hematopoietic progenitor cell antigen CD34(CD34)
Description
Research Area
Images & Validation
−
Key Properties
−| Biological Origin | Homo sapiens (Human) |
|---|---|
| Expression Region | 32-385 |
| Protein Length | full length protein |
| Protein Sequence | SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human CD34 Protein [orb2993854]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 28.3 KDa. Observed: 60-90 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgCD34 Mouse Monoclonal Antibody [orb2988477]
FC, WB
Human, Mouse, Rat
Mouse
Monoclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μlMouse CD34 Protein, hFc Tag [orb1290854]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.3 kDa after removal of the signal peptide. The apparent molecular mass of mCD34-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgRecombinant Human CD34 Protein, C-Fc [orb2964891]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
57.28 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD34 Protein, C-Fc [orb2821152]
>90% as determined by SDS-PAGE.
57.28 kDa
20 μg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].


