Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

SKU: orb2280240

Featured

Description

This Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial spans the amino acid sequence from region 24-545aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Tag	C-terminal hFc1-tagged
Expression Region	24-545aa
Protein Length	Partial
MW	86.5 kDa
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	Liquid or Lyophilized powder
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

IL-12 receptor subunit beta-1;IL-12R subunit beta-1;IL-12R-beta-1;IL-12RB1;IL-12 receptor beta component;CD antigen CD212

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P42701

UniProt Details

−

No UniProt data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	58.5 kDa
Source:	Mammalian cell

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	60.4 kDa
Source:	Baculovirus

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	58.6 kDa
Source:	E.coli

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	85.5 kDa
Source:	E.coli