You have no items in your shopping cart.
Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)
SKU: orb2658099
Featured
Active
Description
Research Area
Immunology & Inflammation; Cell Biology
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 1.343-1.561 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 19-139aa |
| Protein Length | Partial |
| MW | 15.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Antigenic surface determinant protein OA3（Integrin-associated protein）（IAP）（Protein MER6）（CD47）
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days