You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)
SKU: orb1095898
Featured
Active
Description
Research Area
Cancer Biology; Immunology & Inflammation
Images & Validation
−
Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml. |
| Tag | C-terminal hFc1-Flag-tagged |
| Expression Region | 22-401aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 73.5 kDa |
| Purity | Greater than 93.6% as determined by SDS-PAGE. |
| Protein Sequence | ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein(TNFRSF11B) (Active) [orb1650510]
>95% as determined by SDS-PAGE and HPLC.
19.7 kDa
1 mg, 500 μg, 250 μg, 100 μg, 50 μg, 10 μgRecombinant Human Tumor necrosis factor receptor superfamily member 11B protein(TNFRSF11B) (Active) [orb1650511]
>95% as determined by SDS-PAGE and HPLC.
109.6 kDa
1 mg, 500 μg, 250 μg, 100 μg, 50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days