You have no items in your shopping cart.
Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
SKU: orb2659839
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody. The EC50 is 45.77-53.37 ng/mL. ②Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime). |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 29-159aa(R127A,R130S) |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 16.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Thymic stromal lymphopoietin; TSLP

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

