You have no items in your shopping cart.
Recombinant Mouse Stromal cell-derived factor 1 (Cxcl12)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal hFc1-tagged |
| Expression Region | 22-93aa |
| Protein Length | Full Length of Mature Protein |
| MW | 34.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CXCL12/SDF-1 Rabbit Polyclonal Antibody [orb2955148]
ELISA, IHC, WB
Feline, Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgRecombinant Mouse CXCL12/SDF-1 alpha Protein [orb3002374]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.1 KDa. Observed: 10 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Murine Stromal-Cell Derived Factor-1 alpha/CXCL12 (rMuSDF-1a/CXCL12) [orb1495005]
>95% by SDS-PAGE and HPLC analyses.
Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids.
Escherichia coli.
1 mg, 2 μg, 10 μgMouse Cxcl12 Protein, His Tag/His-IF2DI Tag [orb754533]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
7.8 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

