You have no items in your shopping cart.
Featured
Description
Research Area
Cardiovascular Research; Stem Cell & Developmental Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Ovis aries (Sheep) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 10-155aa |
| Protein Length | Full Length of Mature Protein |
| MW | 23.3 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FGF-2;Basic fibroblast growth factor;bFGF;Heparin-binding growth factor 2;HBGF-2
Similar Products
−FGF2 Rabbit Polyclonal Antibody [orb2955585]
ELISA, IHC, WB
Bovine, Gallus, Human, Mouse, Plant, Primate, Rabbit, Rat, Sheep
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgRecombinant Sheep Fibroblast growth factor 2 (FGF2) (Active) [orb2658329]
Greater than 95% as determined by SDS-PAGE.
17.9 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Sheep Fibroblast growth factor 2 (FGF2) [orb2659182]
Greater than 95% as determined by SDS-PAGE.
29.4 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



