You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK 293 |
|---|---|
| Biological Activity | ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells. |
| Purification | > 95% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | ~23 kDa, observed by reducing SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Protein Sequence | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN |
Storage & Handling
−| Storage | Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Rat Interferon-γ (rRtFN-γ) [orb1495057]
>95% by SDS-PAGE and HPLC analyses.
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.
Escherichia coli.
20 μg, 100 μg, 1 mgRecombinant Murine Interferon-γ (rMuIFN-γ) [orb1495059]
>95% by SDS-PAGE and HPLC analyses
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Escherichia coli.
20 μg, 100 μg, 1 mgRecombinant Human Interferon-γ (rHuIFN-γ) [orb1495064]
>98% by SDS-PAGE and HPLC analyses.
Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
Escherichia coli
1 mg, 20 μg, 100 μgHuman IFNB1 Protein, His-IF2DI Tag [orb1098922]
ELISA, WB
Greater than 90% by SDS-PAGE gel analyses
40.7 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].